Cell Culture Growth Factors and Hormones

Highly defined, cell type-specific, and broad-spectrum supplements and hormones that stimulate and support cell proliferation and differentiation.

76 – 90 of 2,252 results

Invitrogen™ Human ZNF502 (aa 78-151) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
Form	Liquid
Formulation	1 M urea, PBS with no preservative; pH 7.4
Sequence	FQEGGFGRITFIHKEAPPEIISQGYNFEKSLLLTSSLVTRLRVSTEESLHQWETSNIQTNDISDQSKCPTLCTQ
Concentration	≥5.0 mg/mL
For Use With (Application)	Blocking Assay,Control
Name	Human ZNF502 (aa 78-151) Control Fragment
Recombinant	Recombinant

Invitrogen™ Human Radixin (aa 395-511) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
Form	Liquid
Formulation	1 M urea, PBS with no preservative; pH 7.4
Sequence	AAEEAKSAIAKQAADQMKNQEQLAAELAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQEDLEKTKEELKTVMSAPPPPPPPPVIPPTENEHDEHDENNAEASAELSNEGVMNHRSE
Concentration	≥5.0 mg/mL
For Use With (Application)	Blocking Assay,Control
Name	Human Radixin (aa 395-511) Control Fragment
Recombinant	Recombinant

Invitrogen™ Human RNF19A (aa 100-159) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
Form	Liquid
Formulation	1 M urea, PBS with no preservative; pH 7.4
Sequence	EMCTDKNSIFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVDCL
Concentration	≥5.0 mg/mL
For Use With (Application)	Blocking Assay,Control
Name	Human RNF19A (aa 100-159) Control Fragment
Recombinant	Recombinant

Invitrogen™ Human PGCP (aa 64-144) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
Form	Liquid
Formulation	1 M urea, PBS with no preservative; pH 7.4
Sequence	YERLALLVDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESAVMLEPRIHKIAILGLGSSIGTPPE
Concentration	≥5.0 mg/mL
For Use With (Application)	Blocking Assay,Control
Name	Human PGCP (aa 64-144) Control Fragment
Recombinant	Recombinant

Invitrogen™ Human Tankyrase (aa 80-145) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
Form	Liquid
Formulation	1 M urea, PBS with no preservative; pH 7.4
Sequence	SPDPVDGTSCCSTTSTICTVAAAPVVPAVSTSSAAGVAPNPAGSGSNNSPSSSSSPTSSSSSSPSS
Concentration	≥5.0 mg/mL
For Use With (Application)	Blocking Assay,Control
Name	Human Tankyrase (aa 80-145) Control Fragment
Recombinant	Recombinant

Invitrogen™ Human CNBD1 (aa 247-340) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
Form	Liquid
Formulation	1 M urea, PBS with no preservative; pH 7.4
Sequence	AEMYLPSYDSMLSKWSTFGTLEVMPQNESETQMFSVVTEDDCEILKIPAKGYAKIKEEKIKLENMQKLKLIRMCPYYEEWPTLSIYELIALLKW
Concentration	≥5.0 mg/mL
For Use With (Application)	Blocking Assay,Control
Name	Human CNBD1 (aa 247-340) Control Fragment
Recombinant	Recombinant

Invitrogen™ Human ADCK5 (aa 379-474) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
Form	Liquid
Formulation	1 M urea, PBS with no preservative; pH 7.4
Sequence	VLLDHGLYQFLEEKDRAALCQLWRAIILRDDAAMRAHAAALGVQDYLLFAEMLMQRPVRLGQLWGSHLLSREEAAYMVDMARERFEAVMAVLRELP
Concentration	≥5.0 mg/mL
For Use With (Application)	Blocking Assay,Control
Name	Human ADCK5 (aa 379-474) Control Fragment
Recombinant	Recombinant

Invitrogen™ Human SAPAP2 (aa 273-372) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
Form	Liquid
Formulation	1 M urea, PBS with no preservative; pH 7.4
Sequence	HSKRSKSKERKPEGKPRPGMSSWWSSDDNLDSDSTYRTPSVLNRHHLGPVAHCYPDALQSPFGDLSLKTSKSNNDVKCSACEGLALTPDAKYLKRSSWST
Concentration	≥5.0 mg/mL
For Use With (Application)	Blocking Assay,Control
Name	Human SAPAP2 (aa 273-372) Control Fragment
Recombinant	Recombinant

Invitrogen™ Human BXDC5 (aa 11-106) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
Form	Liquid
Formulation	1 M urea, PBS with no preservative; pH 7.4
Sequence	SGKKSLKRKAAAEELQEAAGAGDGATENGVQPPKAAAFPPGFSISEIKNKQRRHLMFTRWKQQQRKEKLAAKKKLKKEREALGDKAPPKPVPKTID
Concentration	≥5.0 mg/mL
For Use With (Application)	Blocking Assay,Control
Name	Human BXDC5 (aa 11-106) Control Fragment
Recombinant	Recombinant

Invitrogen™ Human DNAJC6 (aa 471-560) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
Form	Liquid
Formulation	1 M urea, PBS with no preservative; pH 7.4
Sequence	NGDKPHGVKKPSKKQQEPAAPPPPEDVDLLGLEGSAMSNSFSPPAAPPTNSELLSDLFGGGGAAGPTQAGQSGVEDVFHPSGPASTQSTP
Concentration	≥5.0 mg/mL
For Use With (Application)	Blocking Assay,Control
Name	Human DNAJC6 (aa 471-560) Control Fragment
Recombinant	Recombinant

Invitrogen™ Human CCDC181 (aa 32-109) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
Form	Liquid
Formulation	1 M urea, PBS with no preservative; pH 7.4
Sequence	KSDASIIEMACEKEENINQDLKENETVMEHTKRHSDPDKSLQDEVSPRRNDIISVPGIQPLDPISDSDSENSFQESKL
Concentration	≥5.0 mg/mL
For Use With (Application)	Blocking Assay,Control
Name	Human CCDC181 (aa 32-109) Control Fragment
Recombinant	Recombinant

Invitrogen™ Human Calsequestrin 2 (aa 20-84) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
Form	Liquid
Formulation	1 M urea, PBS with no preservative; pH 7.4
Sequence	EEGLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPVSSDKVTQKQFQLKEIVLELVAQVL
Concentration	≥5.0 mg/mL
For Use With (Application)	Blocking Assay,Control
Name	Human Calsequestrin 2 (aa 20-84) Control Fragment
Recombinant	Recombinant

Invitrogen™ Human ODF2L (aa 181-261) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
Form	Liquid
Formulation	1 M urea, PBS with no preservative; pH 7.4
Sequence	SVKVVHERLQIQIHKREAENDKLKEYVKSLETKIAKWNLQSRMNKNEAIVMKEASRQKTVALKKASKVYKQRLDHFTGAIE
Concentration	≥5.0 mg/mL
For Use With (Application)	Blocking Assay,Control
Name	Human ODF2L (aa 181-261) Control Fragment
Recombinant	Recombinant

Invitrogen™ Human PSMB2 (aa 102-178) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
Form	Liquid
Formulation	1 M urea, PBS with no preservative; pH 7.4
Sequence	LLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTF
Concentration	≥5.0 mg/mL
For Use With (Application)	Blocking Assay,Control
Name	Human PSMB2 (aa 102-178) Control Fragment
Recombinant	Recombinant

Invitrogen™ Human Carbonic Anhydrase VI (aa 119-215) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
Form	Liquid
Formulation	1 M urea, PBS with no preservative; pH 7.4
Sequence	SEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTY
Concentration	≥5.0 mg/mL
For Use With (Application)	Blocking Assay,Control
Name	Human Carbonic Anhydrase VI (aa 119-215) Control Fragment
Recombinant	Recombinant

Cell Culture Growth Factors and Hormones

Filtered Search Results

Narrow Results